PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010089349.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HB-other
Protein Properties Length: 84aa    MW: 10152.4 Da    PI: 10.1013
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010089349.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.75.4e-202681156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    ++k ++++++q+++Le++F++ ++p++++r+eL ++lgL+ +qVk+WFqN+R++ k
  XP_010089349.1 26 KKKYHRHNAYQIQRLEAVFKEFPHPDENQRRELGRELGLDPKQVKFWFQNKRTQTK 81
                    79999***********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-201281IPR009057Homeodomain-like
SuperFamilySSF466892.92E-191581IPR009057Homeodomain-like
PROSITE profilePS5007116.3422383IPR001356Homeobox domain
SMARTSM003894.7E-122583IPR001356Homeobox domain
PfamPF000461.4E-172681IPR001356Homeobox domain
CDDcd000861.01E-132681No hitNo description
PRINTSPR000311.8E-55463IPR000047Helix-turn-helix motif
PRINTSPR000311.8E-56379IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MEVEIFSGDE FDQQLQAANS NSRKGKKKYH RHNAYQIQRL EAVFKEFPHP DENQRRELGR  60
ELGLDPKQVK FWFQNKRTQT KVYI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089349.11e-57Homeobox-leucine zipper protein ROC6
SwissprotQ7Y0V78e-29ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLW9SDT92e-57W9SDT9_9R
STRINGBGIOSGA029405-PA3e-27(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1882656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.26e-27HD-ZIP family protein